PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.03G043900.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family ARF
Protein Properties Length: 1059aa    MW: 118326 Da    PI: 6.3343
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.03G043900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B366.83.2e-2170170198
                          EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                          f+k+lt sd++++g +++p++ ae++       + +++  ++l  +d++ + W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F 
  Manes.03G043900.2.p  70 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfsM-QPPA-QELGAKDLHDNAWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFI 157
                          99*****************************954.4444.48************************************************ PP

                          E-SSSEE..EEEEE- CS
                   B3  84 ldgrsefelvvkvfr 98 
                          +  +++ +l+++v+ 
  Manes.03G043900.2.p 158 R--DEKSQLLLGVRH 170
                          4..466667888875 PP

2Auxin_resp126.51.7e-41196278183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          aahaa+++s+F+++YnPras+seFv++++k++ka++++vsvGmRf+m+feteds  rr++Gt++g+sdldpvrW++S+Wr+L+
  Manes.03G043900.2.p 196 AAHAAANNSPFTIFYNPRASPSEFVIPFAKYSKAMYTQVSVGMRFRMMFETEDSGVRRYMGTITGISDLDPVRWKKSQWRNLQ 278
                          79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019366.28E-4460199IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.7E-4062185IPR015300DNA-binding pseudobarrel domain
CDDcd100176.55E-1869162No hitNo description
PfamPF023622.7E-1970170IPR003340B3 DNA binding domain
SMARTSM010192.6E-1970172IPR003340B3 DNA binding domain
PROSITE profilePS5086311.49170172IPR003340B3 DNA binding domain
PfamPF065072.1E-36196278IPR010525Auxin response factor
PfamPF023098.8E-109281017IPR033389AUX/IAA domain
PROSITE profilePS5174526.7389311024IPR000270PB1 domain
SuperFamilySSF542778.83E-99471009No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1059 aa     Download sequence    Send to blast
MQKEADFVPS YPNLPSKLIC MLHNVTLHAD AETDEVYAQM TLQPVSKYDK EALLASDMGL  60
KQSRQPTEFF CKTLTASDTS THGGFSVPRR AAEKIFPPLD FSMQPPAQEL GAKDLHDNAW  120
TFRHIYRGQP KRHLLTTGWS VFVSTKRLFA GDSVLFIRDE KSQLLLGVRH ANKQQSALSS  180
SVISSDSMHI GILAAAAHAA ANNSPFTIFY NPRASPSEFV IPFAKYSKAM YTQVSVGMRF  240
RMMFETEDSG VRRYMGTITG ISDLDPVRWK KSQWRNLQVG WDESAAGERP SRVGIWEIEP  300
VITPFYICPP PFFRPKFPKQ PGMPDDESDI ENAFKRAMPW LGDDFGMKET PSSIFPGLSL  360
VQWMSMQQNN QFPAAQAGFF PPMLPSNALH STLGSDDPSK LLNFQAPGLS VPSLQFNKAN  420
PQNQVGQLPQ PSMAWTQQQQ LQQFLQTNIS QQQPAQPQQL QQQPHPQQQQ RQEPQQQQLS  480
QQPQPEIQPR QIRQQHPQLE QQQQQQIFQP PVNSGVTANS ISNQNLQQPM VYSQLQQQQQ  540
QQLLASNTQS QNIPPANKSS YQLSSLPQDA TLQQQMEQQS TLLQRQQQQT QLQQSPLQLL  600
QQNLSHRTQL PLPQQQVQQL SQPSLSEQQL HLQLLQKMQQ QQQQQQQLLS PTSSPLQPQL  660
LQQQLNHQQN QQFQQSPVSQ SQPQGSNSFS TAALGQSQSF PVCHSHVLQK PPTTNRAHST  720
LTDGDAPSCS TSPSTNNCQI SPSNFMNRNQ ESPAILMGDQ VVEPGTNLVQ ELNNKSDIRV  780
KHEFQSSKGL EQLKYKGTVP DQLEACSSGT SYCLEAGNIQ PNFSLLTYGL DGDIQSHPRN  840
SMPFAANIDS LAPDTLLSRG YDTQKDIQNL VTNYGGTPRD IETELSTAAI SSQTFGVPNI  900
PFKPGCSNDV AINDSGVLNG GLWANQTQRM RTYTKVQKRG SVGRSIDVTR YRGYDELRHD  960
LARMFGIEGQ LEDPQSSDWK LVYVDHENDI LLVGDDPWEE FVSCVQSIKI LSSAEVQQMS  1020
LDGDLGSVPV PNQACSGTDS GNAWRGHYDD NSAASFNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-148829996388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002324725.10.0auxin response factor 1 family protein
TrEMBLB9INC70.0B9INC7_POPTR; Auxin response factor
STRINGPOPTR_0018s07420.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19